TBC1D13 antibody (Middle Region)

Catalog No. ABIN632962

This Rabbit Polyclonal antibody specifically detects TBC1D13 in WB. It exhibits reactivity toward Human and Mouse.

Quick Overview for TBC1D13 antibody (Middle Region) (ABIN632962)

Target: TBC1D13 (TBC1 Domain Family, Member 13 (TBC1D13))

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TBC1D13 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-TBC1D13 Antibody

Binding Specificity: Middle Region

Specificity: TBC1 D13 antibody was raised against the middle region of TBC1 13

Purification: Affinity purified

Immunogen: TBC1 D13 antibody was raised using the middle region of TBC1 13 corresponding to a region with amino acids FLLLVCCAMLMLIREQLLEGDFTVNMRLLQDYPITDVCQILQKAKELQDS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TBC1D13 Blocking Peptide, (ABIN938355), is also available for use as a blocking control in assays to test for specificity of this TBC1D13 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TBC0 13 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TBC1D13

Target: TBC1D13 (TBC1 Domain Family, Member 13 (TBC1D13))

Alternative Name: TBC1D13

Background: TBC1D13 may act as a GTPase-activating protein for Rab family proteins.

Molecular Weight: 44 kDa (MW of target protein)