NT5C1B antibody (N-Term)

Catalog No. ABIN632978

The Rabbit Polyclonal anti-NT5C1B antibody is suitable to detect NT5C1B in samples from Human. It has been validated for WB.

Quick Overview for NT5C1B antibody (N-Term) (ABIN632978)

Target: NT5C1B (5'-Nucleotidase, Cytosolic IB (NT5C1B))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NT5C1B antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-NT5C1B Antibody

Binding Specificity: N-Term

Specificity: NT5 C5 antibody was raised against the N terminal of NT5 5

Purification: Affinity purified

Immunogen: NT5 C5 antibody was raised using the N terminal of NT5 5 corresponding to a region with amino acids MSQTSLKQKKNEPGMRSSKESLEAEKRKESDKTGVRLSNQGSQESSLRKT

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

NT5C1B Blocking Peptide, (ABIN5615073), is also available for use as a blocking control in assays to test for specificity of this NT5C1B antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NT0 0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for NT5C1B

Target: NT5C1B (5'-Nucleotidase, Cytosolic IB (NT5C1B))

Alternative Name: NT5C1B

Background: Cytosolic 5-prime nucleotidases, such as NT5C1B, catalyze production of adenosine, which regulates diverse physiologic processes.

Molecular Weight: 61 kDa (MW of target protein)