Add to Basket
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Zinc Binding Alcohol Dehydrogenase Domain Containing 2 (ZADH2) antibody

Antigen

Zinc Binding Alcohol Dehydrogenase Domain Containing 2 (ZADH2)

Synonyms MGC45594, ZADH2
Clonality Polyclonal
Host
Alternatives

Rabbit

Application
Alternatives Western Blotting (WB)
Catalog no. ABIN633018
Quantity 50 ug  (1 mg/ml)  (Variants)
Price 478.33 $   Plus shipping costs $35.00
Shipping to
Availability Ships within 5 to 7 Business Days

Additional Information

Alternative name ZADH2
Immunogen ZADH2 antibody was raised using the N terminal of ZADH2 corresponding to a region with amino acids MLRLVPTGARAIVDMSYARHFLDFQGSAIPQAMQKLVVTRLSPNFREAVT
Description The function of ZADH2 has not been widely studied, and is yet to be fully elucidated.
Molecular Weight 40 kDa (MW of target protein)

Application Details

Concentration 1 mg/ml
Purification Affinity purified
Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ZADH2 antibody in PBS
Storage Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles.

Alternatives

Alternatives for antigen "Zinc Binding Alcohol Dehydrogenase Domain Containing 2 (ZADH2)", type "Antibodies"
Hosts Rabbit (4)
Reactivities Human (3), Mouse (Murine) (1), Rat (Rattus) (1)
Applications Western Blotting (WB) (4), ELISA (2), Enzyme Immunoassay (EIA) (1)
Epitopes N-Term (2)