RABEPK antibody (N-Term)

Catalog No. ABIN633076

This Rabbit Polyclonal antibody specifically detects RABEPK in WB. It exhibits reactivity toward Human.

Quick Overview for RABEPK antibody (N-Term) (ABIN633076)

Target: RABEPK (Rab9 Effector Protein with Kelch Motifs (RABEPK))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RABEPK antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-RABEPK Antibody

Binding Specificity: N-Term

Specificity: RABEPK antibody was raised against the N terminal of RABEPK

Purification: Affinity purified

Immunogen: RABEPK antibody was raised using the N terminal of RABEPK corresponding to a region with amino acids SCSYLPPVGNAKRGKVFIVGGANPNRSFSDVHTMDLGKHQWDLDTCKGLL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RABEPK Blocking Peptide, (ABIN5615721), is also available for use as a blocking control in assays to test for specificity of this RABEPK antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RABEPK antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RABEPK

Target: RABEPK (Rab9 Effector Protein with Kelch Motifs (RABEPK))

Alternative Name: RABEPK

Background: RABEPK is a rab9 effector required for endosome to trans-Golgi network (TGN) transport.

Molecular Weight: 40 kDa (MW of target protein)