RAPGEF3 antibody

Catalog No. ABIN633118

This Rabbit Polyclonal antibody specifically detects RAPGEF3 in WB. It exhibits reactivity toward Human.

Quick Overview for RAPGEF3 antibody (ABIN633118)

Target: RAPGEF3 (Rap Guanine Nucleotide Exchange Factor (GEF) 3 (RAPGEF3))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RAPGEF3 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-RAPGEF3 Antibody

Purification: Affinity purified

Immunogen: RAPGEF3 antibody was raised using a synthetic peptide corresponding to a region with amino acids RSQVVGICQVLLDEGALCHVKHDWAFQDRDAQFYRFPGPEPEPVGTHEME

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RAPGEF3 Blocking Peptide, (ABIN5615758), is also available for use as a blocking control in assays to test for specificity of this RAPGEF3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAPGEF3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RAPGEF3

Target: RAPGEF3 (Rap Guanine Nucleotide Exchange Factor (GEF) 3 (RAPGEF3))

Alternative Name: RAPGEF3

Background: RAPGEF3 is a guanine nucleotide exchange factor (GEF) for RAP1A and RAP2A small GTPases that is activated by binding cAMP.

Molecular Weight: 99 kDa (MW of target protein)

Pathways: cAMP Metabolic Process