BBS4 antibody (Middle Region)

Catalog No. ABIN633149

The Rabbit Polyclonal anti-BBS4 antibody is suitable to detect BBS4 in samples from Human. It has been validated for WB.

Quick Overview for BBS4 antibody (Middle Region) (ABIN633149)

Target: BBS4 (Bardet-Biedl Syndrome 4 (BBS4))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This BBS4 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-BBS4 Antibody

Binding Specificity: Middle Region

Specificity: BBS4 antibody was raised against the middle region of BBS4

Purification: Affinity purified

Immunogen: BBS4 antibody was raised using the middle region of BBS4 corresponding to a region with amino acids LGIYQKAFEHLGNALTYDPTNYKAILAAGSMMQTHGDFDVALTKYRVVAC

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

BBS4 Blocking Peptide, (ABIN940364), is also available for use as a blocking control in assays to test for specificity of this BBS4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BBS4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for BBS4

Target: BBS4 (Bardet-Biedl Syndrome 4 (BBS4))

Alternative Name: BBS4

Background: This gene is a member of the Bardet-Biedl syndrome (BBS) gene family. Bardet-Biedl syndrome is an autosomal recessive disorder characterized by severe pigmentary retinopathy, obesity, polydactyly, renal malformation and mental retardation. The proteins encoded by BBS gene family members are structurally diverse. The similar phenotypes exhibited by mutations in BBS gene family members are likely due to the protein's shared roles in cilia formation and function. Many BBS proteins localize to the basal bodies, ciliary axonemes, and pericentriolar regions of cells. BBS proteins may also be involved in intracellular trafficking via microtubule-related transport.

Molecular Weight: 58 kDa (MW of target protein)

Pathways: Hedgehog Signaling, Tube Formation, Maintenance of Protein Location