MBL2 antibody (Middle Region)

Catalog No. ABIN633169

This Rabbit Polyclonal antibody specifically detects MBL2 in WB. It exhibits reactivity toward Human.

Quick Overview for MBL2 antibody (Middle Region) (ABIN633169)

Target: MBL2 (Mannose-Binding Lectin (Protein C) 2, Soluble (MBL2))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MBL2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-MBL2 Antibody

Binding Specificity: Middle Region

Specificity: MBL2 antibody was raised against the middle region of MBL2

Purification: Affinity purified

Immunogen: MBL2 antibody was raised using the middle region of MBL2 corresponding to a region with amino acids KEEAFLGITDEKTEGQFVDLTGNRLTYTNWNEGEPNNAGSDEDCVLLLKN

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MBL2 Blocking Peptide, (ABIN939709), is also available for use as a blocking control in assays to test for specificity of this MBL2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MBL2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MBL2

Target: MBL2 (Mannose-Binding Lectin (Protein C) 2, Soluble (MBL2))

Alternative Name: MBL2

Background: This gene encodes the soluble mannose-binding lectin or mannose-binding protein found in serum. The protein encoded belongs to the collectin family and is an important element in the innate immune system. The protein recognises mannose and N-acetylglucosamine on many microorganisms, and is capable of activating the classical complement pathway. Deficiencies of this gene have been associated with susceptibility to autoimmune and infectious diseases.

Molecular Weight: 24 kDa (MW of target protein)

Pathways: Complement System, Positive Regulation of Immune Effector Process