SFRS6 antibody (Middle Region)

Catalog No. ABIN633190

This Rabbit Polyclonal antibody specifically detects SFRS6 in WB. It exhibits reactivity toward Human and Mouse.

Quick Overview for SFRS6 antibody (Middle Region) (ABIN633190)

Target: SFRS6 (SRSF6) (serine/arginine-Rich Splicing Factor 6 (SRSF6))

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SFRS6 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-SFRS6 Antibody

Binding Specificity: Middle Region

Specificity: SFRS6 antibody was raised against the middle region of SFRS6

Purification: Affinity purified

Immunogen: SFRS6 antibody was raised using the middle region of SFRS6 corresponding to a region with amino acids KERTNEGVIEFRSYSDMKRALDKLDGTEINGRNIRLIEDKPRTSHRRSYS

Application Details

Application Notes: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SFRS6 Blocking Peptide, (ABIN939742), is also available for use as a blocking control in assays to test for specificity of this SFRS6 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SFRS6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SFRS6

Target: SFRS6 (SRSF6) (serine/arginine-Rich Splicing Factor 6 (SRSF6))

Alternative Name: SFRS6

Background: SFRS6 is involved in mRNA splicing and may play a role in the determination of alternative splicing. It belongs to the splicing factor SR family and has been shown to bind with and modulate another member of the family, SFRS12.

Molecular Weight: 39 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization