SKIV2L antibody

Catalog No. ABIN633197

The Rabbit Polyclonal anti-SKIV2L antibody is suitable to detect SKIV2L in samples from Human. It has been validated for WB.

Quick Overview for SKIV2L antibody (ABIN633197)

Target: SKIV2L (Superkiller Viralicidic Activity 2-Like (SKIV2L))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SKIV2L antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-SKIV2L Antibody

Purification: Affinity purified

Immunogen: SKIV2 L antibody was raised using a synthetic peptide corresponding to a region with amino acids SSNSTSRVFTTLVLCDKPLSQDPQDRGPATAEVPYPDDLVGFKLFLPEGP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SKIV2L Blocking Peptide, (ABIN5616164), is also available for use as a blocking control in assays to test for specificity of this SKIV2L antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SKIV0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SKIV2L

Target: SKIV2L (Superkiller Viralicidic Activity 2-Like (SKIV2L))

Alternative Name: SKIV2L

Background: DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure.

Molecular Weight: 138 kDa (MW of target protein)