Add to Basket
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

DAZ1 antibody

Antigen

DAZ1

Clonality Polyclonal
Host
Alternatives

Rabbit

Application
Alternatives Western Blotting (WB)
Catalog no. ABIN633207
Quantity 50 ug  (1 mg/ml)
Price 478.33 $   Plus shipping costs $35.00
Shipping to
Availability Ships within 5 to 7 Business Days

Additional Information

Immunogen DAZ1 antibody was raised using the N terminal of DAZ1 corresponding to a region with amino acids MSAANPETPNSTISREASTQSSSAAASQGWVLPEGKIVPNTVFVGGIDAR
Description DAZ1 is a RNA-binding protein that plays an essential role in spermatogenesis. DAZ1 may act by binding to the 3'-UTR of mRNAs and regulating their translation.
Molecular Weight 64 kDa (MW of target protein)

Application Details

Concentration 1 mg/ml
Purification Affinity purified
Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DAZ1 antibody in PBS
Storage Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles.
Research Area Stem Cells, Chromatin Binding Proteins, DNA/RNA

Alternatives

Alternatives for antigen "DAZ1", type "Antibodies"
Hosts Mouse (9), Rabbit (1)
Reactivities Human (10)
Applications Western Blotting (WB) (9), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (8), Enzyme Immunoassay (EIA) (7), ELISA (3), Immunofluorescence (IF) (2)