Snurportin 1 antibody (Middle Region)

Catalog No. ABIN633209

The Rabbit Polyclonal anti-Snurportin 1 antibody is suitable to detect Snurportin 1 in samples from Human, Mouse and Rat. It has been validated for WB.

Quick Overview for Snurportin 1 antibody (Middle Region) (ABIN633209)

Target: Snurportin 1 (SNUPN)

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Snurportin 1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-Snurportin 1 Antibody

Binding Specificity: Middle Region

Specificity: SNUPN antibody was raised against the middle region of SNUPN

Purification: Affinity purified

Immunogen: SNUPN antibody was raised using the middle region of SNUPN corresponding to a region with amino acids GVAVPAGPLTTKPDYAGHQLQQIMEHKKSQKEGMKEKLTHKASENGHYEL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SNUPN Blocking Peptide, (ABIN939014), is also available for use as a blocking control in assays to test for specificity of this SNUPN antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SNUPN antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Snurportin 1

Target: Snurportin 1 (SNUPN)

Alternative Name: SNUPN

Background: The nuclear import of the spliceosomal snRNPs U1, U2, U4 and U5, is dependent on the presence of a complex nuclear localization signal. The latter is composed of the 5'-2,2,7-terminal trimethylguanosine (m3G) cap structure of the U snRNA and the Sm core domain. SNUPN interacts specifically with m3G-cap and functions as an snRNP-specific nuclear import receptor.

Molecular Weight: 41 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization, Protein targeting to Nucleus