SIP1 antibody (Middle Region)

Catalog No. ABIN633250

This Rabbit Polyclonal antibody specifically detects SIP1 in WB. It exhibits reactivity toward Human.

Quick Overview for SIP1 antibody (Middle Region) (ABIN633250)

Target: SIP1 (GEMIN2) (Gem (Nuclear Organelle) Associated Protein 2 (GEMIN2))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SIP1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-SIP1 Antibody

Binding Specificity: Middle Region

Specificity: SIP1 antibody was raised against the middle region of SIP1

Purification: Affinity purified

Immunogen: SIP1 antibody was raised using the middle region of SIP1 corresponding to a region with amino acids HSLIRQLARRCSEVRLLVDSKDDERVPALNLLICLVSRYFDQRDLADEPS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SIP1 Blocking Peptide, (ABIN939242), is also available for use as a blocking control in assays to test for specificity of this SIP1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SIP1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SIP1

Target: SIP1 (GEMIN2) (Gem (Nuclear Organelle) Associated Protein 2 (GEMIN2))

Alternative Name: SIP1

Background: Part of the core SMN complex which plays an essential role in spliceosomal snRNP assembly in the cytoplasm and is required for pre-mRNA splicing in the nucleus.

Molecular Weight: 30 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization, Tube Formation