JAKMIP1 antibody (Middle Region)

Catalog No. ABIN633295

This Rabbit Polyclonal antibody specifically detects JAKMIP1 in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for JAKMIP1 antibody (Middle Region) (ABIN633295)

Target: JAKMIP1 (Janus Kinase and Microtubule Interacting Protein 1 (JAKMIP1))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This JAKMIP1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-JAKMIP1 Antibody

Binding Specificity: Middle Region

Specificity: JAKMIP1 antibody was raised against the middle region of JAKMIP1

Purification: Affinity purified

Immunogen: JAKMIP1 antibody was raised using the middle region of JAKMIP1 corresponding to a region with amino acids FLRLQVLEQQHVIDDLSLERERLLRSKRHRGKSLKPPKKHVVETFFGFDE

Application Details

Application Notes: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

JAKMIP1 Blocking Peptide, (ABIN938367), is also available for use as a blocking control in assays to test for specificity of this JAKMIP1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of JAKMIP1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for JAKMIP1

Target: JAKMIP1 (Janus Kinase and Microtubule Interacting Protein 1 (JAKMIP1))

Alternative Name: JAKMIP1

Background: JAKMIP1 associates with microtubules and may play a role in the microtubule-dependent transport of the GABA-B receptor. It may play a role in JAK1 signaling and regulate microtubule cytoskeleton rearrangements.

Molecular Weight: 97 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interactome