High Density Lipoprotein Binding Protein (HDLBP) antibody

Antigen: High Density Lipoprotein Binding Protein (HDLBP)

Synonyms: HBP, VGL, PRO2900, FLJ16432, AA960365, AI118566, D1Ertd101e, 1110005P14Rik, HDLBP, DKFZp459O137, DKFZp459P222, DKFZp469M026, MGC124559

Clonality: Polyclonal

Host: Rabbit

Application: Western Blotting (WB)

Catalog no.: ABIN633335

Additional Information

Alternative name: HDLBP

Immunogen: HDLBP antibody was raised using a synthetic peptide corresponding to a region with amino acids RLEHDVNIQFPDKDDGNQPQDQITITGYEKNTEAARDAILRIVGELEQMV

Description: HDLBP is high density lipoprotein-binding protein, also known as vigilin, is a 110 kDa protein that specifically binds HDL molecules and may function in the removal of excess cellular cholesterol.High density lipoprotein-binding protein, also known as vigilin, is a 110 kDa protein that specifically binds HDL molecules and may function in the removal of excess cellular cholesterol.High density lipoprotein-binding protein, also known as vigilin, is a 110 kDa protein that specifically binds HDL molecules and may function in the removal of excess cellular cholesterol.

Molecular Weight: 141 kDa (MW of target protein)

Application Details

Concentration: 1 mg/ml

Purification: Affinity purified

Buffer: Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of HDLBP antibody in PBS

Storage: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles.

Research Area: Cardiovascular, Atherosclerosis, Metabolism