SRSF11 antibody (C-Term)

Catalog No. ABIN633352

This Rabbit Polyclonal antibody specifically detects SRSF11 in WB. It exhibits reactivity toward Human.

Quick Overview for SRSF11 antibody (C-Term) (ABIN633352)

Target: SRSF11 (serine/arginine-Rich Splicing Factor 11 (SRSF11))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SRSF11 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-SRSF11 Antibody

Binding Specificity: C-Term

Specificity: SFRS11 antibody was raised against the C terminal of SFRS11

Purification: Affinity purified

Immunogen: SFRS11 antibody was raised using the C terminal of SFRS11 corresponding to a region with amino acids KKKSKDKEKDRERKSESDKDVKQVTRDYDEEEQGYDSEKEKKEEKKPIET

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SFRS11 Blocking Peptide, (ABIN939864), is also available for use as a blocking control in assays to test for specificity of this SFRS11 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SFRS11 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SRSF11

Target: SRSF11 (serine/arginine-Rich Splicing Factor 11 (SRSF11))

Alternative Name: SFRS11

Background: SFRS11 is 54 kDa nuclear protein that contains an arginine/serine-rich region similar to segments found in pre-mRNA splicing factors. Although the function of this protein is not yet known, structure and immunolocalization data suggest that it may play a role in pre-mRNA processing.

Molecular Weight: 53 kDa (MW of target protein)