RBMS3 antibody (Middle Region)

Catalog No. ABIN633376

This Rabbit Polyclonal antibody specifically detects RBMS3 in WB. It exhibits reactivity toward Human.

Quick Overview for RBMS3 antibody (Middle Region) (ABIN633376)

Target: RBMS3 (RNA Binding Motif, Single Stranded Interacting Protein 3 (RBMS3))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RBMS3 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-RBMS3 Antibody

Binding Specificity: Middle Region

Specificity: RBMS3 antibody was raised against the middle region of RBMS3

Purification: Affinity purified

Immunogen: RBMS3 antibody was raised using the middle region of RBMS3 corresponding to a region with amino acids PTAVSIEGVVADTSPQTVAPSSQDTSGQQQQIAVDTSNEHAPAYSYQQSK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RBMS3 Blocking Peptide, (ABIN5615803), is also available for use as a blocking control in assays to test for specificity of this RBMS3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RBMS3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RBMS3

Target: RBMS3 (RNA Binding Motif, Single Stranded Interacting Protein 3 (RBMS3))

Alternative Name: RBMS3

Background: RBMS3 is a member of a small family of proteins which bind single stranded DNA/RNA. These proteins are characterized by the presence of two sets of ribonucleoprotein consensus sequence (RNP-CS) that contain conserved motifs, RNP1 and RNP2.

Molecular Weight: 46 kDa (MW of target protein)