RBMS3 antibody (N-Term)

Catalog No. ABIN629890

Product Details anti-RBMS3 Antibody

Target: RBMS3 (RNA Binding Motif, Single Stranded Interacting Protein 3 (RBMS3))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Dog, Rat, Zebrafish (Danio rerio)

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RBMS3 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: RBMS3 antibody was raised against the N terminal of RBMS3

Purification: Purified

Immunogen: RBMS3 antibody was raised using the N terminal of RBMS3 corresponding to a region with amino acids GVQAQMAKQQEQDPTNLYISNLPISMDEQELENMLKPFGHVISTRILRDA

Application Details

Application Notes: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RBMS3 Blocking Peptide, catalog no. 33R-3651, is also available for use as a blocking control in assays to test for specificity of this RBMS3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RBMS3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RBMS3

Target: RBMS3 (RNA Binding Motif, Single Stranded Interacting Protein 3 (RBMS3))

Alternative Name: RBMS3 (RBMS3 Products)

Synonyms: RBMS3 antibody, zgc:153698 antibody, 6720477E09Rik antibody, 8430436O14Rik antibody, RNA binding motif single stranded interacting protein 3 antibody, RNA binding motif, single stranded interacting protein antibody, RNA binding motif, single stranded interacting protein 3 antibody, RBMS3 antibody, rbms3 antibody, Rbms3 antibody

Background: RBMS3 is a member of a small family of proteins which bind single stranded DNA/RNA. These proteins are characterized by the presence of two sets of ribonucleoprotein consensus sequence (RNP-CS) that contain conserved motifs, RNP1 and RNP2, originally described in RNA binding proteins, and required for DNA binding. These proteins have been implicated in such diverse functions as DNA replication, gene transcription, cell cycle progression and apoptosis.

Molecular Weight: 46 kDa (MW of target protein)