DAZ3 antibody (Middle Region)

Catalog No. ABIN633418

This Rabbit Polyclonal antibody specifically detects DAZ3 in WB. It exhibits reactivity toward Human.

Quick Overview for DAZ3 antibody (Middle Region) (ABIN633418)

Target: DAZ3 (Deleted In Azoospermia 3 (DAZ3))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DAZ3 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-DAZ3 Antibody

Binding Specificity: Middle Region

Specificity: DAZ3 antibody was raised against the middle region of DAZ3

Purification: Affinity purified

Immunogen: DAZ3 antibody was raised using the middle region of DAZ3 corresponding to a region with amino acids PFPAYPRSPFQVTAGYQLPVYNYQAFPAYPNSPFQVATGYQFPVYNYQAF

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DAZ3 Blocking Peptide, (ABIN5613124), is also available for use as a blocking control in assays to test for specificity of this DAZ3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DAZ3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DAZ3

Target: DAZ3 (Deleted In Azoospermia 3 (DAZ3))

Alternative Name: DAZ3

Background: This gene is a member of the DAZ gene family and is a candidate for the human Y-chromosomal azoospermia factor (AZF). Its expression is restricted to premeiotic germ cells, particularly in spermatogonia.

Molecular Weight: 49 kDa (MW of target protein)