KHDRBS3 antibody (N-Term)

Catalog No. ABIN633483

The Rabbit Polyclonal anti-KHDRBS3 antibody (ABIN633483) specifically detects KHDRBS3 in WB. The antibody is reactive with Human samples.

Quick Overview for KHDRBS3 antibody (N-Term) (ABIN633483)

Target: KHDRBS3 (KH Domain Containing, RNA Binding, Signal Transduction Associated 3 (KHDRBS3))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This KHDRBS3 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-KHDRBS3 Antibody

Binding Specificity: N-Term

Specificity: KHDRBS3 antibody was raised against the N terminal of KHDRBS3

Purification: Affinity purified

Immunogen: KHDRBS3 antibody was raised using the N terminal of KHDRBS3 corresponding to a region with amino acids MEEKYLPELMAEKDSLDPSFTHALRLVNQEIEKFQKGEGKDEEKYIDVVI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

KHDRBS3 Blocking Peptide, (ABIN5614318), is also available for use as a blocking control in assays to test for specificity of this KHDRBS3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KHDRBS3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for KHDRBS3

Target: KHDRBS3 (KH Domain Containing, RNA Binding, Signal Transduction Associated 3 (KHDRBS3))

Alternative Name: KHDRBS3

Background: As a RNA-binding protein, KHDRBS3 plays a role in the regulation of alternative splicing and influences mRNA splice site selection and exon inclusion. KHDRBS3 may play a role as a negative regulator of cell growth.

Molecular Weight: 39 kDa (MW of target protein)