Add to Basket
Order hotline:
 |
+1 404 474 4654 |
 |
+1 888 205 9894 (TF) |
Actinin, alpha 2 (ACTN2) antibody
| Antigen | Actinin, alpha 2 (ACTN2) |
| Synonyms | CMD1AA, CEF1, hCDC5, PCDC5RP, KIAA0432, dJ319D22.1, MGC107582, 1110008F24Rik, ACTN2, actn3, actnl, MGC63559, zgc:63559, MGC79034, MGC89234, MGC128123, MGC123223, wu:fd44c03, zgc:123223 |
| Clonality | Polyclonal |
| Host |
 Alternatives Rabbit |
| Application |
Alternatives Western Blotting (WB)
|
| Catalog no. | ABIN633497 |
| Quantity | 50 ug (1 mg/ml) |
| Price | 478.33 $ Plus shipping costs $35.00 |
| Shipping to |
|
| Availability | Ships within 5 to 7 Business Days |
Additional Information
| Alternative name | CDC5L |
| Immunogen | CDC5L antibody was raised using a synthetic peptide corresponding to a region with amino acids LHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATADEQGEFEEEEGEDE |
| Description | CDC5L shares a significant similarity with Schizosaccharomyces pombe cdc5 gene product, which is a cell cycle regulator important for G2/M transition. CDC5L has been demonstrated to act as a positive regulator of cell cycle G2/M progression. It was also found to be an essential component of a non-snRNA spliceosome, which contains at least five additional protein factors and is required for the second catalytic step of pre-mRNA splicing. |
| Molecular Weight | 92 kDa (MW of target protein) |
Application Details
| Concentration | 1 mg/ml |
| Purification | Affinity purified |
| Buffer | Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CDC5L antibody in PBS |
| Storage | Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles. |
| Research Area | Chromatin and Nuclear Signaling, DNA/RNA |
Alternatives
Alternatives for antigen "Actinin, alpha 2 (ACTN2)", type "Antibodies"
| Hosts | Mouse (7), Rabbit (3) |
| Reactivities | Human (10), Cow (Bovine) (1), Mouse (Murine) (1), Rat (Rattus) (1) |
| Applications | Western Blotting (WB) (8), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (4), Immunoprecipitation (IP) (3), ELISA (2), Enzyme Immunoassay (EIA) (2), Flow Cytometry (FACS) (2), Immunocytochemistry (ICC) (2), Immunofluorescence (IF) (2), Immunohistochemistry (Frozen Sections) (IHC (fro)) (2), Dot Blot (Dot) (1), Immunoassay (IA) (1), Immunohistochemistry (IHC) (1) |
