RBM34 antibody (C-Term)

Catalog No. ABIN633521

The Rabbit Polyclonal anti-RBM34 antibody is suitable to detect RBM34 in samples from Human. It has been validated for WB.

Quick Overview for RBM34 antibody (C-Term) (ABIN633521)

Target: RBM34 (RNA Binding Motif Protein 34 (RBM34))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RBM34 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-RBM34 Antibody

Binding Specificity: C-Term

Specificity: RBM34 antibody was raised against the C terminal of RBM34

Purification: Affinity purified

Immunogen: RBM34 antibody was raised using the C terminal of RBM34 corresponding to a region with amino acids SKPKQGLNFTSKTAEGHPKSLFIGEKAVLLKTKKKGQKKSGRPKKQRKQK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RBM34 Blocking Peptide, (ABIN5615787), is also available for use as a blocking control in assays to test for specificity of this RBM34 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RBM34 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RBM34

Target: RBM34 (RNA Binding Motif Protein 34 (RBM34))

Alternative Name: RBM34

Background: RBM34 belongs to the RRM RBM34 family. It contains 2 RRM (RNA recognition motif) domains. The function of the RBM34 protein remains unknown.

Molecular Weight: 48 kDa (MW of target protein)