ZCRB1 antibody (N-Term)

Catalog No. ABIN633544

This Rabbit Polyclonal antibody specifically detects ZCRB1 in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for ZCRB1 antibody (N-Term) (ABIN633544)

Target: ZCRB1 (Zinc Finger CCHC-Type and RNA Binding Motif 1 (ZCRB1))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ZCRB1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-ZCRB1 Antibody

Binding Specificity: N-Term

Specificity: ZCRB1 antibody was raised against the N terminal of ZCRB1

Purification: Affinity purified

Immunogen: ZCRB1 antibody was raised using the N terminal of ZCRB1 corresponding to a region with amino acids MSGGLAPSKSTVYVSNLPFSLTNNDLYRIFSKYGKVVKVTIMKDKDTRKS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ZCRB1 Blocking Peptide, (ABIN5617087), is also available for use as a blocking control in assays to test for specificity of this ZCRB1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ZCRB1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ZCRB1

Target: ZCRB1 (Zinc Finger CCHC-Type and RNA Binding Motif 1 (ZCRB1))

Alternative Name: ZCRB1

Background: Pre-mRNA splicing is catalyzed by the spliceosome. U12-type spliceosome binds U12-type pre-mRNAs and recognises the 5' splice site and branch-point sequence.

Molecular Weight: 24 kDa (MW of target protein)