SNRPA1 antibody (Middle Region)

Catalog No. ABIN633565

This Rabbit Polyclonal antibody specifically detects SNRPA1 in WB and IHC. It exhibits reactivity toward Human, Mouse, Rat and Dog.

Quick Overview for SNRPA1 antibody (Middle Region) (ABIN633565)

Target: SNRPA1 (SNRPA) (Small Nuclear Ribonucleoprotein Polypeptide A (SNRPA))

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SNRPA1 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Product Details anti-SNRPA1 Antibody

Binding Specificity: Middle Region

Specificity: SNRPA antibody was raised against the middle region of SNRPA

Purification: Affinity purified

Immunogen: SNRPA antibody was raised using the middle region of SNRPA corresponding to a region with amino acids MPGQMPPAQPLSENPPNHILFLTNLPEETNELMLSMLFNQFPGFKEVRLV

Application Details

Application Notes: WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SNRPA Blocking Peptide, (ABIN5616322), is also available for use as a blocking control in assays to test for specificity of this SNRPA antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SNRPA antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SNRPA1

Target: SNRPA1 (SNRPA) (Small Nuclear Ribonucleoprotein Polypeptide A (SNRPA))

Alternative Name: SNRPA

Background: SNRPA binds stem loop II of U1 snRNA. It is the first snRNP to interact with pre-mRNA. This interaction is required for the subsequent binding of U2 snRNP and the U4/U6/U5 tri-snRNP. In a snRNP-free form (SF-A) may be involved in coupled pre-mRNA splicing and polyadenylation process.

Molecular Weight: 31 kDa (MW of target protein)