HNRNPM antibody (N-Term)

Catalog No. ABIN633571

This Rabbit Polyclonal antibody specifically detects HNRNPM in WB. It exhibits reactivity toward Human.

Quick Overview for HNRNPM antibody (N-Term) (ABIN633571)

Target: HNRNPM (Heterogeneous Nuclear Ribonucleoprotein M (HNRNPM))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This HNRNPM antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-HNRNPM Antibody

Binding Specificity: N-Term

Specificity: HNRPM antibody was raised against the N terminal Of Hnrpm

Purification: Affinity purified

Immunogen: HNRPM antibody was raised using the N terminal Of Hnrpm corresponding to a region with amino acids ATEIKMEEESGAPGVPSGNGAPGPKGEGERPAQNEKRKEKNIKRGGNRFE

Application Details

Application Notes: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

HNRPM Blocking Peptide, (ABIN936940), is also available for use as a blocking control in assays to test for specificity of this HNRPM antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HNRPM antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for HNRNPM

Target: HNRNPM (Heterogeneous Nuclear Ribonucleoprotein M (HNRNPM))

Alternative Name: HNRPM

Background: HNRPM belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm.

Molecular Weight: 73 kDa (MW of target protein)