SF3A1 antibody (N-Term)

Catalog No. ABIN633574

This Rabbit Polyclonal antibody specifically detects SF3A1 in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for SF3A1 antibody (N-Term) (ABIN633574)

Target: SF3A1 (Splicing Factor 3a, Subunit 1 (SF3A1))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SF3A1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-SF3A1 Antibody

Binding Specificity: N-Term

Specificity: SF3 A1 antibody was raised against the N terminal of SF3 1

Purification: Affinity purified

Immunogen: SF3 A1 antibody was raised using the N terminal of SF3 1 corresponding to a region with amino acids QQTTQQQLPQKVQAQVIQETIVPKEPPPEFEFIADPPSISAFDLDVVKLT

Application Details

Application Notes: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SF3A1 Blocking Peptide, (ABIN5616083), is also available for use as a blocking control in assays to test for specificity of this SF3A1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SF0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SF3A1

Target: SF3A1 (Splicing Factor 3a, Subunit 1 (SF3A1))

Alternative Name: SF3A1

Background: SF3A1 is the subunit 1 of the splicing factor 3a protein complex. The splicing factor 3a heterotrimer includes subunits 1, 2 and 3 and is necessary for the in vitro conversion of 15S U2 snRNP into an active 17S particle that performs pre-mRNA splicing. Subunit 1 belongs to the SURP protein family, named for the SURP motifs that are thought to mediate RNA binding. Subunit 1 has tandemly repeated SURP motifs in its amino-terminal half while its carboxy-terminal half contains a proline-rich region and a ubiquitin-like domain. Binding studies with truncated subunit 1 derivatives demonstrated that the two SURP motifs are necessary for binding to subunit 3 while contacts with subunit 2 may occur through sequences carboxy-terminal to the SURP motifs.

Molecular Weight: 89 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization