IGF2BP1 antibody (Middle Region)

Catalog No. ABIN633589

This Rabbit Polyclonal antibody specifically detects IGF2BP1 in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for IGF2BP1 antibody (Middle Region) (ABIN633589)

Target: IGF2BP1 (Insulin-Like Growth Factor 2 mRNA Binding Protein 1 (IGF2BP1))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This IGF2BP1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-IGF2BP1 Antibody

Binding Specificity: Middle Region

Specificity: IGF2 BP1 antibody was raised against the middle region of IGF2 P1

Purification: Affinity purified

Immunogen: IGF2 BP1 antibody was raised using the middle region of IGF2 P1 corresponding to a region with amino acids YKDRRRRAHTQAEQKRRDAIKRGYDDLQTIVPTCQQQDFSIGSQKLSKAI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

IGF2BP1 Blocking Peptide, (ABIN936112), is also available for use as a blocking control in assays to test for specificity of this IGF2BP1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IGF0 P1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for IGF2BP1

Target: IGF2BP1 (Insulin-Like Growth Factor 2 mRNA Binding Protein 1 (IGF2BP1))

Alternative Name: IGF2BP1

Background: IGF2BP1 is a member of the IGF-II mRNA-binding protein (IMP) family. The protein contains four K homology domains and two RNA recognition motifs. It functions by binding to the 5' UTR of the insulin-like growth factor 2 (IGF2) mRNA and regulating IGF2 translation.

Molecular Weight: 63 kDa (MW of target protein)