DDX17 antibody

Catalog No. ABIN633599

The Rabbit Polyclonal anti-DDX17 antibody is suitable to detect DDX17 in samples from Human and Mouse. It has been validated for WB.

Quick Overview for DDX17 antibody (ABIN633599)

Target: DDX17 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 17 (DDX17))

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DDX17 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-DDX17 Antibody

Purification: Affinity purified

Immunogen: DDX17 antibody was raised using a synthetic peptide corresponding to a region with amino acids PKKFGNPGERLRKKKWDLSELPKFEKNFYVEHPEVARLTPYEVDELRRKK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DDX17 Blocking Peptide, (ABIN5613155), is also available for use as a blocking control in assays to test for specificity of this DDX17 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DDX17 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DDX17

Target: DDX17 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 17 (DDX17))

Alternative Name: DDX17

Background: DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and splicesosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. The DEAD box protein is an ATPase activated by a variety of RNA species but not by dsDNA. This protein and that encoded by DDX5 gene are more closely related to each other than to any other member of the DEAD box family.

Molecular Weight: 80 kDa (MW of target protein)

Pathways: Intracellular Steroid Hormone Receptor Signaling Pathway, Regulation of Intracellular Steroid Hormone Receptor Signaling, Regulation of Muscle Cell Differentiation