ACCN4 antibody (Middle Region)

Catalog No. ABIN633651

The Rabbit Polyclonal anti-ACCN4 antibody (ABIN633651) specifically detects ACCN4 in WB. The antibody is reactive with Human samples.

Quick Overview for ACCN4 antibody (Middle Region) (ABIN633651)

Target: ACCN4 (Amiloride-Sensitive Cation Channel 4, Pituitary (ACCN4))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ACCN4 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-ACCN4 Antibody

Binding Specificity: Middle Region

Specificity: ACCN4 antibody was raised against the middle region of ACCN4

Purification: Affinity purified

Immunogen: ACCN4 antibody was raised using the middle region of ACCN4 corresponding to a region with amino acids NLTRYGKEISMVRIPNRGSARYLARKYNRNETYIRENFLVLDVFFEALTS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ACCN4 Blocking Peptide, (ABIN5611893), is also available for use as a blocking control in assays to test for specificity of this ACCN4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACCN4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ACCN4

Target: ACCN4 (Amiloride-Sensitive Cation Channel 4, Pituitary (ACCN4))

Alternative Name: ACCN4

Background: ACCN4 belongs to the superfamily of acid-sensing ion channels, which are proton-gated, amiloride-sensitive sodium channels. These channels have been implicated in synaptic transmission, pain perception as well as mechanoperception. ACCN4 is predominantly expressed in the pituitary gland, and might be a candidate for paroxysmal dystonic choreoathetosis (PDC), a movement disorder.

Molecular Weight: 73 kDa (MW of target protein)