TRPC4 antibody (Middle Region)

Catalog No. ABIN633715

This Rabbit Polyclonal antibody specifically detects TRPC4 in WB. It exhibits reactivity toward Human.

Quick Overview for TRPC4 antibody (Middle Region) (ABIN633715)

Target: TRPC4 (Transient Receptor Potential Cation Channel, Subfamily C, Member 4 (TRPC4))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TRPC4 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-TRPC4 Antibody

Binding Specificity: Middle Region

Specificity: TRPC4 antibody was raised against the middle region of TRPC4

Purification: Affinity purified

Immunogen: TRPC4 antibody was raised using the middle region of TRPC4 corresponding to a region with amino acids CPFKSEKVVVEDTVPIIPKEKHAKEEDSSIDYDLNLPDTVTHEDYVTTRL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TRPC4 Blocking Peptide, (ABIN937149), is also available for use as a blocking control in assays to test for specificity of this TRPC4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRPC4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TRPC4

Target: TRPC4 (Transient Receptor Potential Cation Channel, Subfamily C, Member 4 (TRPC4))

Alternative Name: TRPC4

Background: TRPC4 is thought to form a receptor-activated non-selective calcium permeant cation channel. TRPC4 probably is operated by a phosphatidylinositol second messenger system activated by receptor tyrosine kinases or G-protein coupled receptors. It has also been shown to be calcium-selective. TRPC4 may also be activated by intracellular calcium store depletion.

Molecular Weight: 112 kDa (MW of target protein)