TRPV4 antibody (Middle Region)

Catalog No. ABIN633737

The Rabbit Polyclonal anti-TRPV4 antibody is suitable to detect TRPV4 in samples from Human. It has been validated for WB.

Quick Overview for TRPV4 antibody (Middle Region) (ABIN633737)

Target: TRPV4 (Transient Receptor Potential Cation Channel, Subfamily V, Member 4 (TRPV4))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TRPV4 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-TRPV4 Antibody

Binding Specificity: Middle Region

Specificity: TRPV4 antibody was raised against the middle region of TRPV4

Purification: Affinity purified

Immunogen: TRPV4 antibody was raised using the middle region of TRPV4 corresponding to a region with amino acids RVDEVNWSHWNQNLGIINEDPGKNETYQYYGFSHTVGRLRRDRWSSVVPR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TRPV4 Blocking Peptide, (ABIN5616816), is also available for use as a blocking control in assays to test for specificity of this TRPV4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRPV4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TRPV4

Target: TRPV4 (Transient Receptor Potential Cation Channel, Subfamily V, Member 4 (TRPV4))

Alternative Name: TRPV4

Background: TRPV4 is a non-selective calcium permeant cation channel probably involved in osmotic sensitivity and mechanosensitivity. Activation of TRPV4 by exposure to hypotonicity within the physiological range exhibits an outward rectification. TRPV4 also activated by low pH, citrate and phorbol esters and increase of intracellular Ca2+ potentiates currents. Channel activity seems to be regulated by a calmodulin-dependent mechanism with a negative feedback mechanism.

Molecular Weight: 91 kDa (MW of target protein)

Pathways: Hormone Transport, Cell-Cell Junction Organization