TRPV5 antibody (N-Term)

Catalog No. ABIN633749

The Rabbit Polyclonal anti-TRPV5 antibody is suitable to detect TRPV5 in samples from Human. It has been validated for WB.

Quick Overview for TRPV5 antibody (N-Term) (ABIN633749)

Target: TRPV5 (Transient Receptor Potential Cation Channel, Subfamily V, Member 5 (TRPV5))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TRPV5 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-TRPV5 Antibody

Binding Specificity: N-Term

Specificity: TRPV5 antibody was raised against the N terminal of TRPV5

Purification: Affinity purified

Immunogen: TRPV5 antibody was raised using the N terminal of TRPV5 corresponding to a region with amino acids MLQQKRILESPLLRASKENDLSVLRQLLLDCTCDVRQRGALGETALHIAA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TRPV5 Blocking Peptide, (ABIN5616818), is also available for use as a blocking control in assays to test for specificity of this TRPV5 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRPV5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TRPV5

Target: TRPV5 (Transient Receptor Potential Cation Channel, Subfamily V, Member 5 (TRPV5))

Alternative Name: TRPV5

Background: TRPV5 is a member of the transient receptor family and the TrpV subfamily. TRPV5, a calcium-selective channel, has 6 transmembrane-spanning domains, multiple potential phosphorylation sites, an N-linked glycosylation site, and 5 ANK repeats. TRPV5 forms homotetramers or heterotetramers and is activated by a low internal calcium level.

Molecular Weight: 82 kDa (MW of target protein)