Cardiotrophin 1 antibody (N-Term)

Catalog No. ABIN633827

The Rabbit Polyclonal anti-Cardiotrophin 1 antibody is suitable to detect Cardiotrophin 1 in samples from Human. It has been validated for WB.

Quick Overview for Cardiotrophin 1 antibody (N-Term) (ABIN633827)

Target: Cardiotrophin 1 (CTF1)

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Cardiotrophin 1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-Cardiotrophin 1 Antibody

Binding Specificity: N-Term

Specificity: Cardiotrophin 1 antibody was raised against the N terminal of CTF1

Purification: Affinity purified

Immunogen: Cardiotrophin 1 antibody was raised using the N terminal of CTF1 corresponding to a region with amino acids MSRREGSLEDPQTDSSVSLLPHLEAKIRQTHSLAHLLTKYAEQLLQEYVQ

Application Details

Application Notes: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Cardiotrophin 1 Blocking Peptide, (ABIN5612622), is also available for use as a blocking control in assays to test for specificity of this Cardiotrophin 1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CTF1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Cardiotrophin 1

Target: Cardiotrophin 1 (CTF1)

Alternative Name: Cardiotrophin 1

Background: CTF1 induces cardiac myocyte hypertrophy in vitro. It binds to and activates the ILST/gp130 receptor. It belongs to the IL-6 superfamily.

Molecular Weight: 21 kDa (MW of target protein)

Pathways: JAK-STAT Signaling