PHYH antibody (Middle Region)

Catalog No. ABIN633832

This Rabbit Polyclonal antibody specifically detects PHYH in WB. It exhibits reactivity toward Human.

Quick Overview for PHYH antibody (Middle Region) (ABIN633832)

Target: PHYH (Phytanoyl-CoA 2-Hydroxylase (PHYH))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PHYH antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-PHYH Antibody

Binding Specificity: Middle Region

Specificity: PHYH antibody was raised against the middle region of PHYH

Purification: Affinity purified

Immunogen: PHYH antibody was raised using the middle region of PHYH corresponding to a region with amino acids EKGDTVFFHPLLIHGSGQNKTQGFRKAISCHFASADCHYIDVKGTSQENI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PHYH Blocking Peptide, (ABIN937889), is also available for use as a blocking control in assays to test for specificity of this PHYH antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PHYH antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PHYH

Target: PHYH (Phytanoyl-CoA 2-Hydroxylase (PHYH))

Alternative Name: PHYH

Background: This gene is a member of the PhyH family and encodes a peroxisomal protein that is involved in the alpha-oxidation of 3-methyl branched fatty acids. Specifically, this protein converts phytanoyl-CoA to 2-hydroxyphytanoyl-CoA.

Molecular Weight: 35 kDa (MW of target protein)

Pathways: Monocarboxylic Acid Catabolic Process