ECHDC2 antibody (Middle Region)

Catalog No. ABIN633844

This Rabbit Polyclonal antibody specifically detects ECHDC2 in WB. It exhibits reactivity toward Human and Rat.

Quick Overview for ECHDC2 antibody (Middle Region) (ABIN633844)

Target: ECHDC2 (Enoyl CoA Hydratase Domain Containing 2 (ECHDC2))

Reactivity: Human, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ECHDC2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-ECHDC2 Antibody

Binding Specificity: Middle Region

Specificity: ECHDC2 antibody was raised against the middle region of ECHDC2

Purification: Affinity purified

Immunogen: ECHDC2 antibody was raised using the middle region of ECHDC2 corresponding to a region with amino acids TQRLPRCLGVALAKELIFTGRRLSGTEAHVLGLVNHAVAQNEEGDAAYQR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ECHDC2 Blocking Peptide, (ABIN5613295), is also available for use as a blocking control in assays to test for specificity of this ECHDC2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ECHDC2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ECHDC2

Target: ECHDC2 (Enoyl CoA Hydratase Domain Containing 2 (ECHDC2))

Alternative Name: ECHDC2

Background: ECHDC2 belongs to the enoyl-CoA hydratase/isomerase family. The exact function of ECHDC2 remains unknown.

Molecular Weight: 28 kDa (MW of target protein)