HRG antibody (Middle Region)

Catalog No. ABIN633866

The Rabbit Polyclonal anti-HRG antibody is suitable to detect HRG in samples from Human. It has been validated for WB.

Quick Overview for HRG antibody (Middle Region) (ABIN633866)

Target: HRG (Histidine-Rich Glycoprotein (HRG))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This HRG antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-HRG Antibody

Binding Specificity: Middle Region

Specificity: HRG antibody was raised against the middle region of HRG

Purification: Affinity purified

Immunogen: HRG antibody was raised using the middle region of HRG corresponding to a region with amino acids HHPHKPHEHGPPPPPDERDHSHGPPLPQGPPPLLPMSCSSCQHATFGTNG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

HRG Blocking Peptide, (ABIN939135), is also available for use as a blocking control in assays to test for specificity of this HRG antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HRG antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for HRG

Target: HRG (Histidine-Rich Glycoprotein (HRG))

Alternative Name: HRG

Background: This histidine-rich glycoprotein(HRG) contains two cystatin-like domains and is located in plasma and platelets. The physiological function has not been determined but it is known that the protein binds heme, dyes and divalent metal ions.

Molecular Weight: 58 kDa (MW of target protein)