Add to Basket
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Fibromodulin (FMOD) antibody

Antigen

Fibromodulin (FMOD)

Synonyms FMOD, SLRR2E, AI131919, AU041740, LUM, Lumican, LOC100008664, LOC100286414, sc:d0415, LOC100229381, MGC129053
Clonality Polyclonal
Host
Alternatives

Rabbit

Application
Alternatives Western Blotting (WB)
Catalog no. ABIN633883
Quantity 50 ug  (1 mg/ml)
Price 478.33 $   Plus shipping costs $35.00
Shipping to
Availability Ships within 5 to 7 Business Days

Additional Information

Alternative name Fibromodulin
Immunogen Fibromodulin antibody was raised using the N terminal of FMOD corresponding to a region with amino acids VYFQNNQITSIQEGVFDNATGLLWIALHGNQITSDKVGRKVFSKLRHLER
Description Fibromodulin is a member of a family of small interstitial proteoglycans, containing a central region composed of leucine-rich repeats with 4 keratan sulfate chains flanked by disulfide-bonded terminal domains. It may participate in the assembly of the extracellular matrix as it interacts with type I and type II collagen fibrils and inhibits fibrillogenesis in vitro. It may also regulate TGF-beta activities by sequestering TGF-beta into the extracellular matrix.
Molecular Weight 41 kDa (MW of target protein)

Application Details

Concentration 1 mg/ml
Purification Affinity purified
Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FMOD antibody in PBS
Storage Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles.
Research Area Signaling, Extracellular Matrix

Alternatives

Alternatives for antigen "Fibromodulin (FMOD)", type "Antibodies"
Hosts Mouse (4)
Reactivities Human (4)
Applications Western Blotting (WB) (4), ELISA (Detection) (3), Enzyme Immunoassay (EIA) (1), Immunohistochemistry (Frozen Sections) (IHC (fro)) (1)