Fibromodulin (FMOD) antibody
| Antigen |
|
| Synonyms |
FMOD, SLRR2E, AI131919, AU041740, LUM, Lumican, LOC100008664, LOC100286414, sc:d0415, LOC100229381, MGC129053 |
| Clonality |
Polyclonal |
|
Host
|
|
|
Application
|
|
| Catalog no. |
ABIN633883 |
| Quantity |
50 ug (1 mg/ml) |
| Price |
478.33 $ Plus shipping costs $35.00
|
| Shipping to |
|
| Availability |
Ships within 5 to 7 Business Days |
|
Alternative name
|
Fibromodulin
|
|
Immunogen
|
Fibromodulin antibody was raised using the N terminal of FMOD corresponding to a region with amino acids VYFQNNQITSIQEGVFDNATGLLWIALHGNQITSDKVGRKVFSKLRHLER
|
|
Description
|
Fibromodulin is a member of a family of small interstitial proteoglycans, containing a central region composed of leucine-rich repeats with 4 keratan sulfate chains flanked by disulfide-bonded terminal domains. It may participate in the assembly of the extracellular matrix as it interacts with type I and type II collagen fibrils and inhibits fibrillogenesis in vitro. It may also regulate TGF-beta activities by sequestering TGF-beta into the extracellular matrix.
|
|
Molecular Weight
|
41 kDa (MW of target protein)
|
|
Concentration
|
1 mg/ml
|
|
Purification
|
Affinity purified
|
|
Buffer
|
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FMOD antibody in PBS
|
|
Storage
|
Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles.
|
|
Research Area
|
Signaling, Extracellular Matrix
|
Alternatives for antigen "Fibromodulin (FMOD)", type "Antibodies"