QPCT antibody

Catalog No. ABIN633915

The Rabbit Polyclonal anti-QPCT antibody (ABIN633915) specifically detects QPCT in WB. The antibody is reactive with Human samples.

Quick Overview for QPCT antibody (ABIN633915)

Target: QPCT (Glutaminyl-Peptide Cyclotransferase (QPCT))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This QPCT antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-QPCT Antibody

Purification: Affinity purified

Immunogen: QPCT antibody was raised using a synthetic peptide corresponding to a region with amino acids SRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

QPCT Blocking Peptide, (ABIN5615693), is also available for use as a blocking control in assays to test for specificity of this QPCT antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of QPCT antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for QPCT

Target: QPCT (Glutaminyl-Peptide Cyclotransferase (QPCT))

Alternative Name: QPCT

Background: QPCT is responsible for the biosynthesis of pyroglutamyl peptides. QPCT has a bias against acidic and tryptophan residues adjacent to the N-terminal glutaminyl residue and a lack of importance of chain length after the second residue. It also catalyzes N-terminal pyroglutamate formation. In vitro, catalyzes pyroglutamate formation of N-terminally truncated form of APP amyloid-beta peptides [Glu-3]-beta-amyloid.

Molecular Weight: 38 kDa (MW of target protein)