MATN1 antibody (Middle Region)

Catalog No. ABIN633926

The Rabbit Polyclonal anti-MATN1 antibody is suitable to detect MATN1 in samples from Human, Mouse and Rat. It has been validated for WB.

Quick Overview for MATN1 antibody (Middle Region) (ABIN633926)

Target: MATN1 (Matrilin 1, Cartilage Matrix Protein (MATN1))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MATN1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-MATN1 Antibody

Binding Specificity: Middle Region

Specificity: Matrilin 1 antibody was raised against the middle region of MATN1

Purification: Affinity purified

Immunogen: Matrilin 1 antibody was raised using the middle region of MATN1 corresponding to a region with amino acids KYLIDNSFTVSSGARPGAQKVGIVFTDGRSQDYINDAAKKAKDLGFKMFA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Matrilin 1 Blocking Peptide, (ABIN940129), is also available for use as a blocking control in assays to test for specificity of this Matrilin 1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MATN1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MATN1

Target: MATN1 (Matrilin 1, Cartilage Matrix Protein (MATN1))

Alternative Name: Matrilin 1

Background: This gene encodes a member of von Willebrand factor A domain containing protein family. This family of proteins are thought to be involved in the formation of filamentous networks in the extracellular matrices of various tissues.

Molecular Weight: 54 kDa (MW of target protein)