CPB1 antibody

Catalog No. ABIN634020

The Rabbit Polyclonal anti-CPB1 antibody (ABIN634020) specifically detects CPB1 in WB. The antibody is reactive with Human samples.

Quick Overview for CPB1 antibody (ABIN634020)

Target: CPB1 (Carboxypeptidase B1 (Tissue) (CPB1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CPB1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-CPB1 Antibody

Purification: Affinity purified

Immunogen: Carboxypeptidase B1 antibody was raised using a synthetic peptide corresponding to a region with amino acids SRVRATGHSYEKYNKWETIEAWTQQVATENPALISRSVIGTTFEGRAIYL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Carboxypeptidase B1 Blocking Peptide, (ABIN5612616), is also available for use as a blocking control in assays to test for specificity of this Carboxypeptidase B1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CPB1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CPB1

Target: CPB1 (Carboxypeptidase B1 (Tissue) (CPB1))

Alternative Name: Carboxypeptidase B1

Background: Three different procarboxypeptidases A and two different procarboxypeptidases B have been isolated. The B1 and B2 forms differ from each other mainly in isoelectric point. Carboxypeptidase B1 is a highly tissue-specific protein and is a useful serum marker for acute pancreatitis and dysfunction of pancreatic transplants. It is not elevated in pancreatic carcinoma.

Molecular Weight: 35 kDa (MW of target protein)