CETP antibody (N-Term)

Catalog No. ABIN634021

This Rabbit Polyclonal antibody specifically detects CETP in WB. It exhibits reactivity toward Human.

Quick Overview for CETP antibody (N-Term) (ABIN634021)

Target: CETP (Cholesteryl Ester Transfer Protein (CETP))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CETP antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-CETP Antibody

Binding Specificity: N-Term

Specificity: CETP antibody was raised against the N terminal of CETP

Purification: Affinity purified

Immunogen: CETP antibody was raised using the N terminal of CETP corresponding to a region with amino acids ALLVLNHETAKVIQTAFQRASYPDITGEKAMMLLGQVKYGLHNIQISHLS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CETP Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this CETP antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CETP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CETP

Target: CETP (Cholesteryl Ester Transfer Protein (CETP))

Alternative Name: CETP

Background: CETP involved in the transfer of insoluble cholesteryl esters in the reverse transport of cholesterol. Defects in CETP are a cause of hyperalphalipoproteinemia.

Molecular Weight: 53 kDa (MW of target protein)