VPS29 antibody

Catalog No. ABIN634054

This Rabbit Polyclonal antibody specifically detects VPS29 in WB. It exhibits reactivity toward Human and Mouse.

Quick Overview for VPS29 antibody (ABIN634054)

Target: VPS29 (Vacuolar Protein Sorting 29 (VPS29))

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This VPS29 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-VPS29 Antibody

Purification: Affinity purified

Immunogen: VPS29 antibody was raised using a synthetic peptide corresponding to a region with amino acids LCTGNLCTKESYDYLKTLAGDVHIVRGDFDENLNYPEQKVVTVGQFKIGL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

VPS29 Blocking Peptide, (ABIN940220), is also available for use as a blocking control in assays to test for specificity of this VPS29 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of VPS29 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for VPS29

Target: VPS29 (Vacuolar Protein Sorting 29 (VPS29))

Alternative Name: VPS29

Background: This gene belongs to a group of vacuolar protein sorting (VPS) genes that, when functionally impaired, disrupt the efficient delivery of vacuolar hydrolases. The protein encoded by this gene is a component of a large multimeric complex.

Molecular Weight: 20 kDa (MW of target protein)