RDH16 antibody

Catalog No. ABIN634066

This Rabbit Polyclonal antibody specifically detects RDH16 in WB. It exhibits reactivity toward Human.

Quick Overview for RDH16 antibody (ABIN634066)

Target: RDH16 (Retinol Dehydrogenase 16 (All-Trans) (RDH16))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RDH16 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-RDH16 Antibody

Purification: Affinity purified

Immunogen: RDH16 antibody was raised using a synthetic peptide corresponding to a region with amino acids SKERFLKSFLEIWDRSSPEVKEAYGEKFVADYKKSAEQMEQKCTQDLSLV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RDH16 Blocking Peptide, (ABIN5615820), is also available for use as a blocking control in assays to test for specificity of this RDH16 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RDH16 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RDH16

Target: RDH16 (Retinol Dehydrogenase 16 (All-Trans) (RDH16))

Alternative Name: RDH16

Background: RDH16 is an oxidoreductase with a preference for NAD. It oxidizes all-trans-retinol and 13-cis-retinol to the corresponding aldehydes. RDH16 has higher activity towards CRBP-bound retinol than with free retinol. It also oxidizes androstanediol and androsterone to dihydrotestosterone and androstanedione. RDH16 can also catalyze the reverse reaction.

Molecular Weight: 36 kDa (MW of target protein)

Pathways: Steroid Hormone Biosynthesis