RPA1 antibody (Middle Region)

Catalog No. ABIN634118

The Rabbit Polyclonal anti-RPA1 antibody is suitable to detect RPA1 in samples from Human, Mouse and Rat. It has been validated for WB.

Quick Overview for RPA1 antibody (Middle Region) (ABIN634118)

Target: RPA1 (Replication Protein A1, 70kDa (RPA1))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RPA1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-RPA1 Antibody

Binding Specificity: Middle Region

Specificity: RPA1 antibody was raised against the middle region of RPA1

Purification: Affinity purified

Immunogen: RPA1 antibody was raised using the middle region of RPA1 corresponding to a region with amino acids SRGEGKLFSLELVDESGEIRATAFNEQVDKFFPLIEVNKVYYFSKGTLKI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RPA1 Blocking Peptide, (ABIN5615927), is also available for use as a blocking control in assays to test for specificity of this RPA1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPA1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RPA1

Target: RPA1 (Replication Protein A1, 70kDa (RPA1))

Alternative Name: RPA1

Background: RPA1 plays an essential role in several cellular processes in DNA metabolism including replication, recombination and DNA repair.

Molecular Weight: 68 kDa (MW of target protein)

Pathways: Telomere Maintenance, DNA Damage Repair, Mitotic G1-G1/S Phases, DNA Replication, Chromatin Binding, Synthesis of DNA