14-3-3 sigma/SFN antibody (Middle Region)

Catalog No. ABIN634143

The Rabbit Polyclonal anti-14-3-3 sigma/SFN antibody (ABIN634143) specifically detects 14-3-3 sigma/SFN in WB. The antibody is reactive with Human, Mouse and Rat samples.

Quick Overview for 14-3-3 sigma/SFN antibody (Middle Region) (ABIN634143)

Target: 14-3-3 sigma/SFN (SFN) (Stratifin (SFN))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This 14-3-3 sigma/SFN antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-14-3-3 sigma/SFN Antibody

Binding Specificity: Middle Region

Specificity: SFN antibody was raised against the middle region of SFN

Purification: Affinity purified

Immunogen: SFN antibody was raised using the middle region of SFN corresponding to a region with amino acids FHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLT

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SFN Blocking Peptide, (ABIN938309), is also available for use as a blocking control in assays to test for specificity of this SFN antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SFN antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for 14-3-3 sigma/SFN

Target: 14-3-3 sigma/SFN (SFN) (Stratifin (SFN))

Alternative Name: SFN

Background: SFN is an adapter protein implicated in the regulation of a large spectrum of both general and specialized signaling pathway. SFN binds to a large number of partners, usually by recognition of a phosphoserine or phosphothreonine motif. Binding generally results in the modulation of the activity of the binding partner. When bound to KRT17, SFN regulates protein synthesis and epithelial cell growth by stimulating Akt/mTOR pathway.

Molecular Weight: 28 kDa (MW of target protein)

Pathways: p53 Signaling, Myometrial Relaxation and Contraction