Add to Basket
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

PBK antibody

Antigen

PBK

Clonality Polyclonal
Host
Alternatives

Rabbit

Application
Alternatives Western Blotting (WB)
Catalog no. ABIN634145
Quantity 50 ug  (1 mg/ml)  (Variants)
Price 478.33 $   Plus shipping costs $35.00
Shipping to
Availability Ships within 5 to 7 Business Days

Additional Information

Immunogen PBK antibody was raised using the N terminal of PBK corresponding to a region with amino acids SLCLAMEYGGEKSLNDLIEERYKASQDPFPAAIILKVALNMARGLKYLHQ
Description PBK is a serine/threonine kinase related to the dual specific mitogen-activated protein kinase kinase (MAPKK) family. Evidence suggests that mitotic phosphorylation is required for its catalytic activity. This mitotic kinase may be involved in the activation of lymphoid cells and support testicular functions, with a suggested role in the process of spermatogenesis.
Molecular Weight 36 kDa (MW of target protein)

Application Details

Concentration 1 mg/ml
Purification Affinity purified
Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PBK antibody in PBS
Storage Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles.
Research Area Cancer, Cell Cycle, DNA/RNA

Alternatives

Alternatives for antigen "PBK", type "Antibodies"
Hosts Mouse (8), Rabbit (3)
Reactivities Human (11)
Applications ELISA (10), Western Blotting (WB) (9), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (8), Immunofluorescence (IF) (6), Immunohistochemistry (IHC) (1)
Epitopes C-Term (1)