PAFAH1B1 antibody (N-Term)

Catalog No. ABIN634232

The Rabbit Polyclonal anti-PAFAH1B1 antibody is suitable to detect PAFAH1B1 in samples from Human, Rat and Mouse. It has been validated for WB.

Quick Overview for PAFAH1B1 antibody (N-Term) (ABIN634232)

Target: PAFAH1B1 (Platelet-Activating Factor Acetylhydrolase 1b, Regulatory Subunit 1 (45kDa) (PAFAH1B1))

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PAFAH1B1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-PAFAH1B1 Antibody

Binding Specificity: N-Term

Specificity: PAFAH1 B1 antibody was raised against the N terminal of PAFAH1 1

Purification: Affinity purified

Immunogen: PAFAH1 B1 antibody was raised using the N terminal of PAFAH1 1 corresponding to a region with amino acids MVLSQRQRDELNRAIADYLRSNGYEEAYSVFKKEAELDVNEELDKKYAGL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PAFAH1B1 Blocking Peptide, (ABIN5615190), is also available for use as a blocking control in assays to test for specificity of this PAFAH1B1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PAFAH0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PAFAH1B1

Target: PAFAH1B1 (Platelet-Activating Factor Acetylhydrolase 1b, Regulatory Subunit 1 (45kDa) (PAFAH1B1))

Alternative Name: PAFAH1B1

Background: This locus was identified as encoding a gene that when mutated or lost caused the lissencephaly associated with Miller-Dieker lissencephaly syndrome. PAFAH1B1 is the non-catalytic alpha subunit of the intracellular Ib isoform of platelet-activating factor acteylhydrolase, a heterotrimeric enzyme that specifically catalyzes the removal of the acetyl group at the SN-2 position of platelet-activating factor (identified as 1-O-alkyl-2-acetyl-sn-glyceryl-3-phosphorylcholine).

Molecular Weight: 47 kDa (MW of target protein)

Pathways: M Phase, Regulation of Cell Size