ABCF2 antibody

Catalog No. ABIN634277

The Rabbit Polyclonal anti-ABCF2 antibody is suitable to detect ABCF2 in samples from Human. It has been validated for WB.

Quick Overview for ABCF2 antibody (ABIN634277)

Target: ABCF2 (ATP-Binding Cassette, Sub-Family F (GCN20), Member 2 (ABCF2))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ABCF2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-ABCF2 Antibody

Purification: Affinity purified

Immunogen: ABCF2 antibody was raised using a synthetic peptide corresponding to a region with amino acids DIYHLTREMPPSDKTPLHCVMEVDTERAMLEKEAERLAHEDAECEKLMEL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ABCF2 Blocking Peptide, (ABIN937399), is also available for use as a blocking control in assays to test for specificity of this ABCF2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ABCF2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ABCF2

Target: ABCF2 (ATP-Binding Cassette, Sub-Family F (GCN20), Member 2 (ABCF2))

Alternative Name: ABCF2

Background: The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intracellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, and White). This protein is a member of the GCN20 subfamily. Alternative splicing of this gene results in multiple transcript variants.

Molecular Weight: 72 kDa (MW of target protein)