PARK7/DJ1 antibody

Catalog No. ABIN634300

This Rabbit Polyclonal antibody specifically detects PARK7/DJ1 in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for PARK7/DJ1 antibody (ABIN634300)

Target: PARK7/DJ1 (PARK7) (Parkinson Protein 7 (PARK7))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PARK7/DJ1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-PARK7/DJ1 Antibody

Purification: Affinity purified

Immunogen: PARK7 antibody was raised using a synthetic peptide corresponding to a region with amino acids TYSENRVEKDGLILTSRGPGTSFEFALAIVEALNGKEVAAQVKAPLVLKD

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PARK7 Blocking Peptide, (ABIN5615219), is also available for use as a blocking control in assays to test for specificity of this PARK7 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PARK7 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PARK7/DJ1

Target: PARK7/DJ1 (PARK7) (Parkinson Protein 7 (PARK7))

Alternative Name: PARK7

Background: PARK7 belongs to the peptidase C56 family of proteins. It acts as a positive regulator of androgen receptor-dependent transcription. It may also function as a redox-sensitive chaperone, as a sensor for oxidative stress, and it apparently protects neurons against oxidative stress and cell death. Defects in this gene are the cause of autosomal recessive early-onset Parkinson disease 7.

Molecular Weight: 20 kDa (MW of target protein)

Pathways: Intracellular Steroid Hormone Receptor Signaling Pathway, Regulation of Intracellular Steroid Hormone Receptor Signaling, Proton Transport