CHN1 antibody

Catalog No. ABIN634308

The Rabbit Polyclonal anti-CHN1 antibody (ABIN634308) specifically detects CHN1 in WB. The antibody is reactive with Human, Mouse and Rat samples.

Quick Overview for CHN1 antibody (ABIN634308)

Target: CHN1 (ARHGAP2) (rho GTPase Activating Protein 2 (ARHGAP2))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CHN1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-CHN1 Antibody

Purification: Affinity purified

Immunogen: CHN1 antibody was raised using a synthetic peptide corresponding to a region with amino acids KVYSCDLTTLVKAHTTKRPMVVDMCIREIESRGLNSEGLYRVSGFSDLIE

Application Details

Application Notes: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CHN1 Blocking Peptide, (ABIN940114), is also available for use as a blocking control in assays to test for specificity of this CHN1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHN1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CHN1

Target: CHN1 (ARHGAP2) (rho GTPase Activating Protein 2 (ARHGAP2))

Alternative Name: CHN1

Background: CHN1 contains 1 phorbol-ester/DAG-type zinc finger, 1 Rho-GAP domain and 1 SH2 domain. CHN1 is a GTPase-activating protein for p21-rac and a phorbol ester receptor. It may play an important role in neuronal signal-transduction mechanisms.

Molecular Weight: 53 kDa (MW of target protein)