Add to Basket
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Dimethylarginine Dimethylaminohydrolase 1 (DDAH1) antibody

Antigen

Dimethylarginine Dimethylaminohydrolase 1 (DDAH1)

Synonyms DDAH, FLJ21264, FLJ25539, AI987801, AW050362, 2410006N07Rik, 2510015N06Rik, fc30c11, wu:fc30c11, ddah1, MGC69055, DDAH1, MGC165853
Clonality Polyclonal
Host
Alternatives

Rabbit

Application
Alternatives Western Blotting (WB)
Catalog no. ABIN634364
Quantity 50 ug  (1 mg/ml)  (Variants)
Price 478.33 $   Plus shipping costs $35.00
Shipping to
Availability Ships within 5 to 7 Business Days

Additional Information

Alternative name DDAH1
Immunogen DDAH1 antibody was raised using the middle region of DDAH1 corresponding to a region with amino acids ALEKLQLNIVEMKDENATLDGGDVLFTGREFFVGLSKRTNQRGAEILADT
Description DDAH1 belongs to the dimethylarginine dimethylaminohydrolase (DDAH) family. This enzyme plays a role in nitric oxide generation by regulating cellular concentrations of methylarginines, which in turn inhibit nitric oxide synthase activity.
Molecular Weight 31 kDa (MW of target protein)

Application Details

Concentration 1 mg/ml
Purification Affinity purified
Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DDAH1 antibody in PBS
Storage Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles.
Research Area Neurology

Alternatives

Alternatives for antigen "Dimethylarginine Dimethylaminohydrolase 1 (DDAH1)", type "Antibodies"
Hosts Goat (5), Rabbit (5), Mouse (3)
Reactivities Human (11), Cow (Bovine) (1), Mouse (Murine) (1)
Applications Western Blotting (WB) (12), ELISA (3), ELISA (Detection) (3), Enzyme Immunoassay (EIA) (3), Flow Cytometry (FACS) (1), Immunohistochemistry (IHC) (1), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (1)
Epitopes C-Term (3)